General Information

  • ID:  hor002400
  • Uniprot ID:  Q76IQ4
  • Protein name:  Ghrelin-24
  • Gene name:  GHRL
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  Highest levels in the stomach. Moderate levels in the brain, hypothalamus and intestinal tracts.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010628 positive regulation of gene expression; GO:0030252 growth hormone secretion; GO:0032099 negative regulation of appetite; GO:0042594 response to starvation; GO:0051480 regulation of cytosolic calcium ion concentration; GO:1901671 positive regulation of superoxide dismutase activity
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GSSFLSPSQKPQVRQGKGKPPRVG
  • Length:  24(27-50)
  • Propeptide:  MPLKRNTGLMILMLCTLALWAKSVSAGSSFLSPSQKPQVRQGKGKPPRVGRRDIESFAELFEGPLHQEDKHNTIKAPFEMGITMSEEEFQEYGAVLQKILQDVLGDTATAE
  • Signal peptide:  MPLKRNTGLMILMLCTLALWAKSVSA
  • Modification:  T23 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation. Induces the release of growth hormone from the pituitary.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q76IQ4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002400_AF2.pdbhor002400_ESM.pdb

Physical Information

Mass: 293329 Formula: C110H184N36O32
Absent amino acids: ACDEHIMNTWY Common amino acids: GPS
pI: 12.55 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 4
Hydrophobicity: -114.17 Boman Index: -5697
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 40.42
Instability Index: 4932.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12970156
  • Title:  Peptide Purification, Complementary Deoxyribonucleic Acid (DNA) and Genomic DNA Cloning, and Functional Characterization of Ghrelin in Rainbow Trout